Lineage for d5kxdd_ (5kxd D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781436Species Wisteria floribunda [TaxId:3922] [322647] (4 PDB entries)
  8. 2781444Domain d5kxdd_: 5kxd D: [322670]
    automated match to d4u36a_
    complexed with 6y2, act, ca, mn, nag

Details for d5kxdd_

PDB Entry: 5kxd (more details), 1.95 Å

PDB Description: wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 6.5
PDB Compounds: (D:) Wisteria floribunda agglutinin

SCOPe Domain Sequences for d5kxdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kxdd_ b.29.1.0 (D:) automated matches {Wisteria floribunda [TaxId: 3922]}
kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps

SCOPe Domain Coordinates for d5kxdd_:

Click to download the PDB-style file with coordinates for d5kxdd_.
(The format of our PDB-style files is described here.)

Timeline for d5kxdd_: