Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.56: MAPEG domain-like [161083] (1 superfamily) 4 helices, bundle; left-handed superhelix |
Superfamily f.56.1: MAPEG domain-like [161084] (2 families) |
Family f.56.1.0: automated matches [193735] (1 protein) not a true family |
Protein automated matches [193736] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193737] (14 PDB entries) |
Domain d5k0ia_: 5k0i A: [322619] automated match to d4yl1a_ complexed with 6pw, bog, gsh, pg4 |
PDB Entry: 5k0i (more details), 1.3 Å
SCOPe Domain Sequences for d5k0ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k0ia_ f.56.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slvmsspalpafllcstllvikmyvvaiitgqvrlrkkafanpedalrhggpqycrsdpd verclrahrndmetiypflflgfvysflgpnpfvawmhflvflvgrvahtvaylgklrap irsvtytlaqlpcasmalqilweaarhl
Timeline for d5k0ia_: