SCOPe 2.08: Domain d5ixsa1: 5ixs A:1-159

Lineage for d5ixsa1 (5ixs A:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries)

8. Domain d5ixsa1: 5ixs A:1-159 [322592]
   Other proteins in same PDB: d5ixsa2, d5ixsb2, d5ixsc2, d5ixsd2
   automated match to d1i10d1
   complexed with 6ey, epe, nai, so4, txd

Details for d5ixsa1

PDB Entry: 5ixs, 2.05 Å

PDB Description: lactate dehydrogenase in complex with hydroxylactam inhibitor compound 9: (6r)-3-[(2-chlorophenyl)sulfanyl]-4-hydroxy-6-(3-hydroxyphenyl)-6- (thiophen-3-yl)-5,6-dihydropyridin-2(1h)-one

PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5ixsa1:

Sequence, based on SEQRES records:

>d5ixsa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d5ixsa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqsrlnlvqrnvnifkfiipnvv
kyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d5ixsa1:

• d5ixsa1 first appeared in SCOPe 2.06
  
• d5ixsa1 appears in SCOPe 2.07