Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Candida albicans [TaxId:237561] [322564] (6 PDB entries) |
Domain d5htga_: 5htg A: [322589] automated match to d4iq2a_ |
PDB Entry: 5htg (more details), 2.4 Å
SCOPe Domain Sequences for d5htga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5htga_ d.26.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]} eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn gq
Timeline for d5htga_: