Lineage for d5b1bi_ (5b1b I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630428Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
    automatically mapped to Pfam PF02937
  5. 2630429Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 2630430Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630431Species Cow (Bos taurus) [TaxId:9913] [81412] (52 PDB entries)
  8. 2630452Domain d5b1bi_: 5b1b I: [322558]
    Other proteins in same PDB: d5b1ba_, d5b1bb1, d5b1bb2, d5b1bc_, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bh_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bp_, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bu_, d5b1bw_, d5b1bx_, d5b1by_, d5b1bz_
    automated match to d1v54i_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5b1bi_

PDB Entry: 5b1b (more details), 1.6 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d5b1bi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1bi_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d5b1bi_:

Click to download the PDB-style file with coordinates for d5b1bi_.
(The format of our PDB-style files is described here.)

Timeline for d5b1bi_: