SCOPe 2.08: Domain d5d1zc1: 5d1z C:2-107

Lineage for d5d1zc1 (5d1z C:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5d1zc1: 5d1z C:2-107 [322546]
   Other proteins in same PDB: d5d1za2, d5d1zc2, d5d1ze2, d5d1zh2, d5d1zi_, d5d1zj_
   automated match to d1dn0a1

Details for d5d1zc1

PDB Entry: 5d1z, 3.17 Å

PDB Description: isdb neat1 bound by clone d4-10

PDB Compounds: (C:) D4-10 Light Chain

SCOPe Domain Sequences for d5d1zc1:

Sequence; same for both SEQRES and ATOM records:

>d5d1zc1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqltqspsflsasvadrvtitcrasqavrsslawyqqkpgkapqlliysastlengvss
rfsgsgpgteftltisslqpedvgtyycqqlntypftfgpgtkvei

Timeline for d5d1zc1:

• d5d1zc1 first appeared in SCOPe 2.06
  
• d5d1zc1 appears in SCOPe 2.07