Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [197337] (2 PDB entries) |
Domain d5ebgb_: 5ebg B: [322536] automated match to d2q3ab_ |
PDB Entry: 5ebg (more details), 1.8 Å
SCOPe Domain Sequences for d5ebgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ebgb_ b.1.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} lsfrmsptqketrlgekvelqcellqsgmatgcswlrhipgddprptflmylsaqrvkla egldprhisgakvsgtkfqltlssflqedqgyyfcsvvsnsilyfsnfvpvflp
Timeline for d5ebgb_: