Lineage for d5cm0a_ (5cm0 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248742Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2248743Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2248862Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2248863Protein automated matches [190815] (13 species)
    not a true protein
  7. 2248887Species Geoglobus acetivorans [TaxId:565033] [322475] (2 PDB entries)
  8. 2248888Domain d5cm0a_: 5cm0 A: [322535]
    automated match to d2eiya_
    complexed with gol, plp

Details for d5cm0a_

PDB Entry: 5cm0 (more details), 1.9 Å

PDB Description: crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans
PDB Compounds: (A:) Branched-chain transaminase

SCOPe Domain Sequences for d5cm0a_:

Sequence, based on SEQRES records: (download)

>d5cm0a_ e.17.1.0 (A:) automated matches {Geoglobus acetivorans [TaxId: 565033]}
ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwgk
lygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngy
isegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysade
ifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr

Sequence, based on observed residues (ATOM records): (download)

>d5cm0a_ e.17.1.0 (A:) automated matches {Geoglobus acetivorans [TaxId: 565033]}
ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwek
glkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngyisegsgdn
ifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysadeifvtgtaa
eiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr

SCOPe Domain Coordinates for d5cm0a_:

Click to download the PDB-style file with coordinates for d5cm0a_.
(The format of our PDB-style files is described here.)

Timeline for d5cm0a_: