Lineage for d5cm0c_ (5cm0 C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573222Species Geoglobus acetivorans [TaxId:565033] [322475] (2 PDB entries)
  8. 2573225Domain d5cm0c_: 5cm0 C: [322531]
    automated match to d2eiya_
    complexed with gol, plp

Details for d5cm0c_

PDB Entry: 5cm0 (more details), 1.9 Å

PDB Description: crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans
PDB Compounds: (C:) Branched-chain transaminase

SCOPe Domain Sequences for d5cm0c_:

Sequence, based on SEQRES records: (download)

>d5cm0c_ e.17.1.0 (C:) automated matches {Geoglobus acetivorans [TaxId: 565033]}
ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwgk
lygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngy
isegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysade
ifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy

Sequence, based on observed residues (ATOM records): (download)

>d5cm0c_ e.17.1.0 (C:) automated matches {Geoglobus acetivorans [TaxId: 565033]}
ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwkg
lkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngyisegsgdni
fivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysadeifvtgtaae
iapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy

SCOPe Domain Coordinates for d5cm0c_:

Click to download the PDB-style file with coordinates for d5cm0c_.
(The format of our PDB-style files is described here.)

Timeline for d5cm0c_: