Lineage for d5b1au_ (5b1a U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327892Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2327893Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries)
  8. 2327899Domain d5b1au_: 5b1a U: [322516]
    Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1as_, d5b1at_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d5b1au_

PDB Entry: 5b1a (more details), 1.5 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d5b1au_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1au_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d5b1au_:

Click to download the PDB-style file with coordinates for d5b1au_.
(The format of our PDB-style files is described here.)

Timeline for d5b1au_: