Lineage for d5ewsc_ (5ews C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780893Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)
  8. 2781025Domain d5ewsc_: 5ews C: [322499]
    automated match to d1c1la_

Details for d5ewsc_

PDB Entry: 5ews (more details), 2 Å

PDB Description: sugar binding protein - human galectin-2
PDB Compounds: (C:) galectin-2

SCOPe Domain Sequences for d5ewsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ewsc_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtgelevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsl
dgsnwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvr
ggfnmssfklk

SCOPe Domain Coordinates for d5ewsc_:

Click to download the PDB-style file with coordinates for d5ewsc_.
(The format of our PDB-style files is described here.)

Timeline for d5ewsc_: