SCOPe 2.06: Domain d5ddxb_: 5ddx B:

Lineage for d5ddxb_ (5ddx B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)

8. Domain d5ddxb_: 5ddx B: [322483]
   Other proteins in same PDB: d5ddxa_
   automated match to d4nf8b_
   complexed with 5dy, gly, peg, trs

Details for d5ddxb_

PDB Entry: 5ddx, 1.95 Å

PDB Description: crystal structure of glun1/glun2a nmda receptor agonist binding domains with glycine and antagonist, 4-(3-fluoropropyl)phenyl-acepc

PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5ddxb_:

Sequence, based on SEQRES records:

>d5ddxb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcid
ilkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevv
dfsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypym
hqymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgy
gialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records):

>d5ddxb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dnhlsivtleeapfvivedidtetcvrntvpcrkfvkinnstnegmnvkkcckgfcidil
kklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdf
svpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhq
ymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygi
alqkgspwkrqidlallqfvgdgemeeletlwltgic

Timeline for d5ddxb_:

• d5ddxb_ is new in SCOPe 2.06-stable
  
• d5ddxb_ does not appear in SCOPe 2.07