SCOPe 2.08: Domain d5dg2a_: 5dg2 A:

Lineage for d5dg2a_ (5dg2 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)

8. Domain d5dg2a_: 5dg2 A: [322482]
   automated match to d1hlca_

Details for d5dg2a_

PDB Entry: 5dg2, 1.61 Å

PDB Description: sugar binding protein - human galectin-2 (dimer)

PDB Compounds: (A:) galectin-2

SCOPe Domain Sequences for d5dg2a_:

Sequence; same for both SEQRES and ATOM records:

>d5dg2a_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elevknmdmkpgstlkitgsiadgtdgfvinlgqgtdklnlhfnprfsestivcnsldgs
nwgqeqredhlcfspgsevkftvtfesdkfkvklpdgheltfpnrlghshlsylsvrggf
nmssfklk

Timeline for d5dg2a_:

• d5dg2a_ first appeared in SCOPe 2.06
  
• d5dg2a_ appears in SCOPe 2.07