Lineage for d5b1bp_ (5b1b P:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255238Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2255239Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 2255240Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2255253Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2255254Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries)
  8. 2255274Domain d5b1bp_: 5b1b P: [322447]
    Other proteins in same PDB: d5b1ba_, d5b1bb1, d5b1bb2, d5b1bd_, d5b1be_, d5b1bf_, d5b1bg_, d5b1bh_, d5b1bi_, d5b1bj_, d5b1bk_, d5b1bl_, d5b1bm_, d5b1bn_, d5b1bo1, d5b1bo2, d5b1bq_, d5b1br_, d5b1bs_, d5b1bt_, d5b1bu_, d5b1bv_, d5b1bw_, d5b1bx_, d5b1by_, d5b1bz_
    automated match to d1v54c_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5b1bp_

PDB Entry: 5b1b (more details), 1.6 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5b1bp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1bp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d5b1bp_:

Click to download the PDB-style file with coordinates for d5b1bp_.
(The format of our PDB-style files is described here.)

Timeline for d5b1bp_: