Lineage for d5k3jb1 (5k3j B:2-278)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246333Species Caenorhabditis elegans [TaxId:6239] [321813] (3 PDB entries)
  8. 2246339Domain d5k3jb1: 5k3j B:2-278 [322443]
    Other proteins in same PDB: d5k3ja2, d5k3ja3, d5k3ja4, d5k3jb2, d5k3jb3, d5k3jb4
    automated match to d2ddha3
    complexed with 6qa, atp, fad, mg

Details for d5k3jb1

PDB Entry: 5k3j (more details), 2.68 Å

PDB Description: crystals structure of acyl-coa oxidase-2 in caenorhabditis elegans bound with fad, ascaroside-coa, and atp
PDB Compounds: (B:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3jb1:

Sequence, based on SEQRES records: (download)

>d5k3jb1 e.6.1.0 (B:2-278) automated matches {Caenorhabditis elegans [TaxId: 6239]}
anrsirdgdnpelleerrmatfdtdkmaaviygseefarrrreitdavskipeladikpy
pfltreekvtegtrkisiltkylnqlidrdneeeslhlhrevigyeghpfalhdalfipt
lqsqasdeqqekwlerarrreiigcyaqtelghgsnlrnlettavydiasqefvlhtptt
talkwwpgalgkscnyalvvaeliikrnnygphffmvqlrdekthiplkgvtvgdigpkm
nfnaadngylglnnlrvprtnllmrhckveadgtyvk

Sequence, based on observed residues (ATOM records): (download)

>d5k3jb1 e.6.1.0 (B:2-278) automated matches {Caenorhabditis elegans [TaxId: 6239]}
anrsirdgdnpelleerrmatfdtdkmaaviygseefarrrreitdavskipeladikpy
pfltreekvtegtrkisiltkylnqlidrdneeeslhlhrevigyeghpfalhdalfipt
lqsqasdeqqekwlerarrreiigcyaqtelghgsnlrnlettavydiasqefvlhtptt
talkwwpgalgkscnyalvvaelnygphffmvqlrdekthiplkgvtvgdigpkmnfnaa
dngylglnnlrvprtnllmrhckveadgtyvk

SCOPe Domain Coordinates for d5k3jb1:

Click to download the PDB-style file with coordinates for d5k3jb1.
(The format of our PDB-style files is described here.)

Timeline for d5k3jb1: