Lineage for d5k05b_ (5k05 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2468840Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2468851Protein Catechol O-methyltransferase, COMT [53337] (2 species)
  7. 2468864Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (86 PDB entries)
  8. 2468960Domain d5k05b_: 5k05 B: [322430]
    automated match to d4pyoa_
    complexed with 6p5, so4

Details for d5k05b_

PDB Entry: 5k05 (more details), 2.14 Å

PDB Description: crystal structure of comt in complex with 4-methyl-2-(4-methylphenyl)- 5-(1h-pyrazol-5-yl)-1,3-thiazole
PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5k05b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k05b_ c.66.1.1 (B:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d5k05b_:

Click to download the PDB-style file with coordinates for d5k05b_.
(The format of our PDB-style files is described here.)

Timeline for d5k05b_: