SCOPe 2.08: Domain d5k0jb_: 5k0j B:

Lineage for d5k0jb_ (5k0j B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.1: COMT-like [53336] (4 proteins)

6. Protein Catechol O-methyltransferase, COMT [53337] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries)

8. Domain d5k0jb_: 5k0j B: [322353]
   automated match to d4pyna_
   complexed with 6p2, na, nhe

Details for d5k0jb_

PDB Entry: 5k0j, 1.94 Å

PDB Description: crystal structure of comt in complex with 5-[5-[1-(4-methoxyphenyl) cyclopropyl]-1h-pyrazol-3-yl]-2,4-dimethyl-1,3-thiazole

PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d5k0jb_:

Sequence; same for both SEQRES and ATOM records:

>d5k0jb_ c.66.1.1 (B:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
vlelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqd
lipqlkkkydvdtldmvfldhwkdrylpdtllleecgllrkgtvlladnvivpgtpdfla
yvrgsssfecthyssyleymkvvdglekaiyqgpsspdks

Timeline for d5k0jb_:

• d5k0jb_ first appeared in SCOPe 2.06
  
• d5k0jb_ appears in SCOPe 2.07