Lineage for d5syia1 (5syi A:36-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005634Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 2005733Protein automated matches [227103] (4 species)
    not a true protein
  7. 2005747Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)
  8. 2005776Domain d5syia1: 5syi A:36-443 [322337]
    automated match to d3n3oa1
    complexed with cl, hem, mpd, na, niz, oxy, po4

Details for d5syia1

PDB Entry: 5syi (more details), 1.7 Å

PDB Description: structure of d141a variant of b. pseudomallei katg complexed with inh
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d5syia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5syia1 a.93.1.3 (A:36-443) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpananldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d5syia1:

Click to download the PDB-style file with coordinates for d5syia1.
(The format of our PDB-style files is described here.)

Timeline for d5syia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5syia2