Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (25 species) not a true protein |
Species Caenorhabditis elegans [TaxId:6239] [321813] (3 PDB entries) |
Domain d5k3ig1: 5k3i G:2-281 [322314] Other proteins in same PDB: d5k3ic2, d5k3ic3, d5k3id2, d5k3id3, d5k3if2, d5k3if3, d5k3ig2, d5k3ig3 automated match to d2ddha3 complexed with atp, fad, mg |
PDB Entry: 5k3i (more details), 2.68 Å
SCOPe Domain Sequences for d5k3ig1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3ig1 e.6.1.0 (G:2-281) automated matches {Caenorhabditis elegans [TaxId: 6239]} vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp kmaynivdngflgfnnyriprtnllmrhtkveadgtyikp
Timeline for d5k3ig1: