Lineage for d5t06c_ (5t06 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943647Protein automated matches [190155] (3 species)
    not a true protein
  7. 2943648Species Escherichia coli [TaxId:83334] [319369] (3 PDB entries)
  8. 2943655Domain d5t06c_: 5t06 C: [322284]
    automated match to d1s5uc_
    complexed with edo, hxc

Details for d5t06c_

PDB Entry: 5t06 (more details), 1.9 Å

PDB Description: crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa
PDB Compounds: (C:) Acyl-CoA thioester hydrolase ybgC

SCOPe Domain Sequences for d5t06c_:

Sequence, based on SEQRES records: (download)

>d5t06c_ d.38.1.1 (C:) automated matches {Escherichia coli [TaxId: 83334]}
ttlfrwpvrvyyedtaaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkm
tveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpr
alpksivaef

Sequence, based on observed residues (ATOM records): (download)

>d5t06c_ d.38.1.1 (C:) automated matches {Escherichia coli [TaxId: 83334]}
ttlfrwpvrvyyedtaaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkm
tveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdpkpralp
ksivaef

SCOPe Domain Coordinates for d5t06c_:

Click to download the PDB-style file with coordinates for d5t06c_.
(The format of our PDB-style files is described here.)

Timeline for d5t06c_: