Lineage for d2n78a_ (2n78 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790168Protein automated matches [190915] (12 species)
    not a true protein
  7. 2790185Species Pseudomonas aeruginosa [TaxId:287] [322282] (1 PDB entry)
  8. 2790186Domain d2n78a_: 2n78 A: [322283]
    automated match to d2n3sa_

Details for d2n78a_

PDB Entry: 2n78 (more details)

PDB Description: nmr structure of if1 from pseudomonas aeruginosa
PDB Compounds: (A:) Translation initiation factor IF-1

SCOPe Domain Sequences for d2n78a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n78a_ b.40.4.5 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mskedsfemegtvvdtlpntmfrvelenghvvtahisgkmrknyiriltgdkvrveltpy
dlskgrityrar

SCOPe Domain Coordinates for d2n78a_:

Click to download the PDB-style file with coordinates for d2n78a_.
(The format of our PDB-style files is described here.)

Timeline for d2n78a_: