Lineage for d5sxxa1 (5sxx A:36-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005634Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
    duplication: tandem repeat of two CCP-like domains
  6. 2005733Protein automated matches [227103] (4 species)
    not a true protein
  7. 2005747Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)
  8. 2005772Domain d5sxxa1: 5sxx A:36-443 [322279]
    automated match to d3n3oa1
    complexed with cl, hem, mpd, na, oxy, po4

Details for d5sxxa1

PDB Entry: 5sxx (more details), 1.7 Å

PDB Description: crystal structure of the e198a variant of burkholderia pseudomallei catalase-peroxidase katg with inh
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d5sxxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxxa1 a.93.1.3 (A:36-443) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepadvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d5sxxa1:

Click to download the PDB-style file with coordinates for d5sxxa1.
(The format of our PDB-style files is described here.)

Timeline for d5sxxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5sxxa2