Lineage for d2n9ua1 (2n9u A:142-266)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (75 species)
    not a true protein
  7. 2438791Species Erythrobacter litoralis [TaxId:314225] [322270] (1 PDB entry)
  8. 2438792Domain d2n9ua1: 2n9u A:142-266 [322271]
    Other proteins in same PDB: d2n9ua2
    automated match to d2fspa_

Details for d2n9ua1

PDB Entry: 2n9u (more details)

PDB Description: solution nmr structure of erythrobacter litoralis phyr response regulator rec domain
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d2n9ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9ua1 c.23.1.0 (A:142-266) automated matches {Erythrobacter litoralis [TaxId: 314225]}
stnvliiedeplismqledlvrslghdiagtaatrtqaqeavakekpglvladiqladgs
sgidavedilgqfdvpvifitayperlltgdrpeptylvtkpfqestvrttisqalffqn
sptav

SCOPe Domain Coordinates for d2n9ua1:

Click to download the PDB-style file with coordinates for d2n9ua1.
(The format of our PDB-style files is described here.)

Timeline for d2n9ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2n9ua2