Lineage for d5kvwa_ (5kvw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2777888Protein Thaumatin [49876] (1 species)
  7. 2777889Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (117 PDB entries)
    Uniprot P02883
  8. 2777958Domain d5kvwa_: 5kvw A: [322248]
    automated match to d1kwna_
    complexed with gol, tla

Details for d5kvwa_

PDB Entry: 5kvw (more details), 1.59 Å

PDB Description: t. danielli thaumatin at 100k, data set 1
PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d5kvwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvwa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOPe Domain Coordinates for d5kvwa_:

Click to download the PDB-style file with coordinates for d5kvwa_.
(The format of our PDB-style files is described here.)

Timeline for d5kvwa_: