Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (25 species) not a true protein |
Species Caenorhabditis elegans [TaxId:6239] [321813] (3 PDB entries) |
Domain d5k3ja1: 5k3j A:3-278 [322216] Other proteins in same PDB: d5k3ja2, d5k3ja3, d5k3ja4, d5k3jb2, d5k3jb3, d5k3jb4 automated match to d2ddha3 complexed with 6qa, atp, fad, mg |
PDB Entry: 5k3j (more details), 2.68 Å
SCOPe Domain Sequences for d5k3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3ja1 e.6.1.0 (A:3-278) automated matches {Caenorhabditis elegans [TaxId: 6239]} nrsirdgdnpelleerrmatfdtdkmaaviygseefarrrreitdavskipeladikpyp fltreekvtegtrkisiltkylnqlidrdneeeslhlhrevigyeghpfalhdalfiptl qsqasdeqqekwlerarrreiigcyaqtelghgsnlrnlettavydiasqefvlhtpttt alkwwpgalgkscnyalvvaeliikrnnygphffmvqlrdekthiplkgvtvgdigpkmn fnaadngylglnnlrvprtnllmrhckveadgtyvk
Timeline for d5k3ja1:
View in 3D Domains from other chains: (mouse over for more information) d5k3jb1, d5k3jb2, d5k3jb3, d5k3jb4 |