Lineage for d5c9ta_ (5c9t A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100508Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2100509Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2100530Protein automated matches [195320] (6 species)
    not a true protein
  7. 2100545Species Mycobacterium tuberculosis [TaxId:83332] [319883] (22 PDB entries)
  8. 2100552Domain d5c9ta_: 5c9t A: [322213]
    automated match to d2jqxa_
    complexed with 4z0, mg

Details for d5c9ta_

PDB Entry: 5c9t (more details), 2.04 Å

PDB Description: crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)but-3-enoic acid
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d5c9ta_:

Sequence, based on SEQRES records: (download)

>d5c9ta_ c.1.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
avdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfeg
imdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlg
lpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkg
tmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastaw
vpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnn
cqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvras
lermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrref
karaae

Sequence, based on observed residues (ATOM records): (download)

>d5c9ta_ c.1.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
rvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgli
aihglkasdgplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigimd
eerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilaye
dhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlhal
hyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrwv
dqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrqn
agdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae

SCOPe Domain Coordinates for d5c9ta_:

Click to download the PDB-style file with coordinates for d5c9ta_.
(The format of our PDB-style files is described here.)

Timeline for d5c9ta_:

  • d5c9ta_ appears in periodic updates to SCOPe 2.06 starting on 2016-09-07
  • d5c9ta_ became obsolete in SCOPe 2.07