Lineage for d5k3id3 (5k3i D:488-669)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1994829Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1994963Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1994964Protein automated matches [226935] (26 species)
    not a true protein
  7. 1995044Species Caenorhabditis elegans [TaxId:6239] [321815] (3 PDB entries)
  8. 1995048Domain d5k3id3: 5k3i D:488-669 [322210]
    Other proteins in same PDB: d5k3ic1, d5k3id1, d5k3if1, d5k3ig1
    automated match to d2ddha2
    complexed with atp, fad, mg

Details for d5k3id3

PDB Entry: 5k3i (more details), 2.68 Å

PDB Description: crystal structure of acyl-coa oxidase-1 in caenorhabditis elegans complexed with fad and atp
PDB Compounds: (D:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3id3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3id3 a.29.3.0 (D:488-669) automated matches {Caenorhabditis elegans [TaxId: 6239]}
iteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfiveaf
arrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfylqki
rpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylkpmme
ka

SCOPe Domain Coordinates for d5k3id3:

Click to download the PDB-style file with coordinates for d5k3id3.
(The format of our PDB-style files is described here.)

Timeline for d5k3id3: