SCOPe 2.08: Domain d5ayuh_: 5ayu H:

Lineage for d5ayuh_ (5ayu H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)

8. Domain d5ayuh_: 5ayu H: [322204]
   Other proteins in same PDB: d5ayul_
   automated match to d3a6ch_
   complexed with gol

Details for d5ayuh_

PDB Entry: 5ayu, 1.8 Å

PDB Description: crystal structure of hyhel-10 fv

PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d5ayuh_:

Sequence; same for both SEQRES and ATOM records:

>d5ayuh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsa

Timeline for d5ayuh_:

• d5ayuh_ first appeared in SCOPe 2.06
  
• d5ayuh_ appears in SCOPe 2.07