Lineage for d5ddza_ (5ddz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000154Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries)
  8. 3000156Domain d5ddza_: 5ddz A: [322179]
    automated match to d1br6a_

Details for d5ddza_

PDB Entry: 5ddz (more details), 1.5 Å

PDB Description: crystal structure of the rta-c10-p2 complex
PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d5ddza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ddza_ d.165.1.1 (A:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcappp

SCOPe Domain Coordinates for d5ddza_:

Click to download the PDB-style file with coordinates for d5ddza_.
(The format of our PDB-style files is described here.)

Timeline for d5ddza_: