Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:1085] [320959] (4 PDB entries) |
Domain d5l8gv_: 5l8g V: [322115] Other proteins in same PDB: d5l8ga2, d5l8gb2, d5l8gc2, d5l8gd2, d5l8gf2, d5l8gg2, d5l8gh2, d5l8gi2, d5l8gj2, d5l8gk2, d5l8gl2, d5l8gn2, d5l8gp2, d5l8gt2, d5l8gu2 automated match to d1zpyg_ complexed with ca; mutant |
PDB Entry: 5l8g (more details), 2.97 Å
SCOPe Domain Sequences for d5l8gv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8gv_ a.25.1.0 (V:) automated matches {Rhodospirillum rubrum [TaxId: 1085]} stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa amtlewlrrndakwaehlrtylftegpit
Timeline for d5l8gv_:
View in 3D Domains from other chains: (mouse over for more information) d5l8ga1, d5l8ga2, d5l8gb1, d5l8gb2, d5l8gc1, d5l8gc2, d5l8gd1, d5l8gd2, d5l8ge_, d5l8gf1, d5l8gf2, d5l8gg1, d5l8gg2, d5l8gh1, d5l8gh2, d5l8gi1, d5l8gi2, d5l8gj1, d5l8gj2, d5l8gk1, d5l8gk2, d5l8gl1, d5l8gl2, d5l8gm_, d5l8gn1, d5l8gn2, d5l8go_, d5l8gp1, d5l8gp2, d5l8gq_, d5l8gr_, d5l8gs_, d5l8gt1, d5l8gt2, d5l8gu1, d5l8gu2, d5l8gw_, d5l8gx_, d5l8gy_, d5l8gz_ |