Lineage for d1dbs__ (1dbs -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins) Protein Dethiobiotin synthetase [52653] (1 species) Species Escherichia coli [TaxId:562] [52654] (13 PDB entries) 
Domain d1dbs__: 1dbs - [32209]
Details for d1dbs__
PDB Entry: 1dbs (more details), 1.8 Å
PDB Description: mechanistic implications and family relationships from the structure of dethiobiotin synthetase
SCOP Domain Sequences for d1dbs__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbs__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall
SCOP Domain Coordinates for d1dbs__:
Click to download the PDB-style file with coordinates for d1dbs__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dbs__:
- d1dbs__ appears in SCOP 1.57
- d1dbs__ appears in the current release, SCOPe 2.08, called d1dbsa_
View in 3D