Lineage for d5t0ta_ (5t0t A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210919Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 2210923Protein automated matches [191006] (1 species)
    not a true protein
  7. 2210924Species Human (Homo sapiens) [TaxId:9606] [188753] (14 PDB entries)
  8. 2210937Domain d5t0ta_: 5t0t A: [322088]
    Other proteins in same PDB: d5t0tb_
    automated match to d4h6ja_
    complexed with 72q

Details for d5t0ta_

PDB Entry: 5t0t (more details), 2.2 Å

PDB Description: crystal structure of pt2399 bound to hif2a-b*:arnt-b* complex
PDB Compounds: (A:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d5t0ta_:

Sequence, based on SEQRES records: (download)

>d5t0ta_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlse

Sequence, based on observed residues (ATOM records): (download)

>d5t0ta_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlse

SCOPe Domain Coordinates for d5t0ta_:

Click to download the PDB-style file with coordinates for d5t0ta_.
(The format of our PDB-style files is described here.)

Timeline for d5t0ta_:

  • d5t0ta_ is new in SCOPe 2.06-stable
  • d5t0ta_ does not appear in SCOPe 2.07