Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins) contains PAC motif |
Protein automated matches [191006] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188753] (14 PDB entries) |
Domain d5t0ta_: 5t0t A: [322088] Other proteins in same PDB: d5t0tb_ automated match to d4h6ja_ complexed with 72q |
PDB Entry: 5t0t (more details), 2.2 Å
SCOPe Domain Sequences for d5t0ta_:
Sequence, based on SEQRES records: (download)
>d5t0ta_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlse
>d5t0ta_ d.110.3.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct kgqvvsgqyrmlakhggyvwletqgtviynppqcimcvnyvlse
Timeline for d5t0ta_: