SCOPe 2.08: Domain d4zhob1: 4zho B:2-96

Lineage for d4zhob1 (4zho B:2-96)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [322058] (1 PDB entry)

8. Domain d4zhob1: 4zho B:2-96 [322059]
   Other proteins in same PDB: d4zhoa2, d4zhob2
   automated match to d1pfda_
   complexed with cl, fes

Details for d4zhob1

PDB Entry: 4zho, 2.34 Å

PDB Description: the crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster

PDB Compounds: (B:) Ferredoxin-2, chloroplastic

SCOPe Domain Sequences for d4zhob1:

Sequence; same for both SEQRES and ATOM records:

>d4zhob1 d.15.4.0 (B:2-96) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
atykvkfitpegelevecdddvyvldaaeeagidlpyscragscsscagkvvsgsvdqsd
qsflddeqigegfvltcaayptsdvtiethkeeai

Timeline for d4zhob1:

• d4zhob1 first appeared in SCOPe 2.06
  
• d4zhob1 appears in SCOPe 2.07