Lineage for d5svza_ (5svz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333294Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2333295Protein automated matches [190220] (14 species)
    not a true protein
  7. 2333381Species Mouse (Mus musculus) [TaxId:10090] [272712] (12 PDB entries)
  8. 2333382Domain d5svza_: 5svz A: [322045]
    automated match to d1un0b_

Details for d5svza_

PDB Entry: 5svz (more details), 2 Å

PDB Description: hiv-1 tat nls in complex with importin alpha
PDB Compounds: (A:) Importin subunit alpha-1

SCOPe Domain Sequences for d5svza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5svza_ a.118.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
iekyfs

SCOPe Domain Coordinates for d5svza_:

Click to download the PDB-style file with coordinates for d5svza_.
(The format of our PDB-style files is described here.)

Timeline for d5svza_: