Lineage for d5lbfa_ (5lbf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2816443Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
    Pfam PF13640; PubMed 16782814
  6. 2816451Protein automated matches [254532] (2 species)
    not a true protein
  7. 2816459Species Human (Homo sapiens) [TaxId:9606] [255179] (35 PDB entries)
  8. 2816491Domain d5lbfa_: 5lbf A: [322019]
    automated match to d3ouja_
    protein/DNA complex; complexed with bct, mn, so4, un9

Details for d5lbfa_

PDB Entry: 5lbf (more details), 1.9 Å

PDB Description: hif prolyl hydroxylase 2 (phd2/egln1) k293k/g294e variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl) carbonyl]glycine (iox3/fg2216)
PDB Compounds: (A:) Egl nine homolog 1

SCOPe Domain Sequences for d5lbfa_:

Sequence, based on SEQRES records: (download)

>d5lbfa_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds
skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykikertkamvacypgng
tgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw
sdrrnphevqpayatryaitvwyfdaderarakvkyltgekgvrve

Sequence, based on observed residues (ATOM records): (download)

>d5lbfa_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds
skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykikertkamvacypgng
tgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw
sdrrnphevqpayatryaitvwyfdaderarakvkylekgvrve

SCOPe Domain Coordinates for d5lbfa_:

Click to download the PDB-style file with coordinates for d5lbfa_.
(The format of our PDB-style files is described here.)

Timeline for d5lbfa_: