SCOPe 2.08: Domain d5jrsb1: 5jrs B:396-655

Lineage for d5jrsb1 (5jrs B:396-655)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d5jrsb1: 5jrs B:396-655 [321975]
   Other proteins in same PDB: d5jrsa2, d5jrsb2
   automated match to d4z3va_
   complexed with 6mv

Details for d5jrsb1

PDB Entry: 5jrs, 1.97 Å

PDB Description: crystal structure of bruton agammaglobulinemia tyrosine kinase complexed with 4-[2-fluoro-3-(4-oxo -3,4-dihydroquinazolin-3-yl) phenyl]-7-(2-hydroxypropan-2-y l)-9h-carbazole-1-carboxamide

PDB Compounds: (B:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5jrsb1:

Sequence, based on SEQRES records:

>d5jrsb1 d.144.1.7 (B:396-655) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlshe
klvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameylesk
qflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskfs
sksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwh
ekaderptfkillsnildvm

Sequence, based on observed residues (ATOM records):

>d5jrsb1 d.144.1.7 (B:396-655) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eidpkdltflkelgtgqfgvvkygkwrgqydvaikmiksmsedefieeakvmmnlshekl
vqlygvctifiiteymangcllnylrefqtqqllemckdvceameyleskqflhrdlaar
nclvndqgvvkvsdfglsryvkfpvrwsppevlmyskfssksdiwafgvlmweiyslgkm
pyerftnsetaehiaqglrlyrphlasekvytimyscwhekaderptfkillsnildvm

Timeline for d5jrsb1:

• d5jrsb1 first appeared in SCOPe 2.06
  
• d5jrsb1 appears in SCOPe 2.07