Class b: All beta proteins [48724] (177 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (13 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189158] (3 PDB entries) |
Domain d5e5ua_: 5e5u A: [321974] Other proteins in same PDB: d5e5ub1, d5e5ub2, d5e5ub3, d5e5ud1, d5e5ud2, d5e5ud3 automated match to d3kldb_ complexed with 1ps, acy, fmt, mli, mlt |
PDB Entry: 5e5u (more details), 2 Å
SCOPe Domain Sequences for d5e5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e5ua_ b.74.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dpywaysgaygpehwvtssvscggshqspidildhharvgdeyqelqldgfdnessnktw mkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfpvemqi ffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpf ilrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhv ksveylrnnfrpqqalndrvvsks
Timeline for d5e5ua_: