Lineage for d5e5ua_ (5e5u A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077896Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2077897Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2078811Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2078812Protein automated matches [191011] (13 species)
    not a true protein
  7. 2078923Species Mouse (Mus musculus) [TaxId:10090] [189158] (3 PDB entries)
  8. 2078929Domain d5e5ua_: 5e5u A: [321974]
    Other proteins in same PDB: d5e5ub1, d5e5ub2, d5e5ub3, d5e5ud1, d5e5ud2, d5e5ud3
    automated match to d3kldb_
    complexed with 1ps, acy, fmt, mli, mlt

Details for d5e5ua_

PDB Entry: 5e5u (more details), 2 Å

PDB Description: crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn6
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase gamma

SCOPe Domain Sequences for d5e5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e5ua_ b.74.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dpywaysgaygpehwvtssvscggshqspidildhharvgdeyqelqldgfdnessnktw
mkntgktvaillkddyfvsgaglpgrfkaekvefhwghsngsagsehsvngrrfpvemqi
ffynpddfdsfqtaisenriigamaiffqvsprdnsaldpiihglkgvvhheketfldpf
ilrdllpaslgsyyrytgslttppcseivewivfrrpvpisyhqleafysiftteqqdhv
ksveylrnnfrpqqalndrvvsks

SCOPe Domain Coordinates for d5e5ua_:

Click to download the PDB-style file with coordinates for d5e5ua_.
(The format of our PDB-style files is described here.)

Timeline for d5e5ua_: