Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species) PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries) |
Domain d5dg5a_: 5dg5 A: [321932] automated match to d4eeva_ complexed with 5b4 |
PDB Entry: 5dg5 (more details), 2.6 Å
SCOPe Domain Sequences for d5dg5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dg5a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
Timeline for d5dg5a_: