Lineage for d1bg2__ (1bg2 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.9: Motor proteins [52641] (3 proteins) Protein Kinesin [52646] (2 species) Species Human (Homo sapiens) [TaxId:9606] [52647] (1 PDB entry) 
Domain d1bg2__: 1bg2 - [32189]
Details for d1bg2__
PDB Entry: 1bg2 (more details), 1.8 Å
PDB Description: human ubiquitous kinesin motor domain
SCOP Domain Sequences for d1bg2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg2__ c.37.1.9 (-) Kinesin {Human (Homo sapiens)}
dlaecnikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvy
ndcakkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysm
denlefhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgcterfvcspdevmdt
idegksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsktg
aegavldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggncrttivicc
spssynesetkstllfgqrakti
SCOP Domain Coordinates for d1bg2__:
Click to download the PDB-style file with coordinates for d1bg2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bg2__:
- d1bg2__ appears in SCOP 1.57
- d1bg2__ appears in the current release, SCOPe 2.08, called d1bg2a_
View in 3D