Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.145: NadA-like [142753] (1 superfamily) duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134 |
Superfamily c.145.1: NadA-like [142754] (2 families) automatically mapped to Pfam PF02445 |
Family c.145.1.0: automated matches [238306] (1 protein) not a true family |
Protein automated matches [238307] (1 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [238308] (15 PDB entries) |
Domain d5f35a1: 5f35 A:1-298 [321886] Other proteins in same PDB: d5f35a2 automated match to d4p3xa_ complexed with flc, mg, sf4 |
PDB Entry: 5f35 (more details), 1.6 Å
SCOPe Domain Sequences for d5f35a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f35a1 c.145.1.0 (A:1-298) automated matches {Thermotoga maritima [TaxId: 243274]} mvdeilklkkekgyiilahnyqipelqdiadfvgdslqlarkamelsekkilflgvdfma elvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstsecktladv ictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqfnaesida vrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigmihklkkk fpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrmfelmg
Timeline for d5f35a1: