Lineage for d5kwyd_ (5kwy D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039052Family b.1.18.7: ML domain [81287] (3 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 2039074Protein automated matches [321839] (1 species)
    not a true protein
  7. 2039075Species Homo sapiens [TaxId:9606] [321840] (1 PDB entry)
  8. 2039077Domain d5kwyd_: 5kwy D: [321841]
    Other proteins in same PDB: d5kwyc2
    automated match to d1nepa_
    complexed with c3s, nag

Details for d5kwyd_

PDB Entry: 5kwy (more details), 2.41 Å

PDB Description: structure of human npc1 middle lumenal domain bound to npc2
PDB Compounds: (D:) Epididymal secretory protein E1

SCOPe Domain Sequences for d5kwyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwyd_ b.1.18.7 (D:) automated matches {Homo sapiens [TaxId: 9606]}
epvqfkdcgsvdgvikevnvspcptqpcqlskgqsysvnvtftsniqsksskavvhgilm
gvpvpfpipepdgcksgincpiqkdktysylnklpvkseypsiklvvewqlqddknqslf
cweipvqivshl

SCOPe Domain Coordinates for d5kwyd_:

Click to download the PDB-style file with coordinates for d5kwyd_.
(The format of our PDB-style files is described here.)

Timeline for d5kwyd_: