Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.7: ML domain [81287] (3 proteins) implicated in lipid recognition, particularly in the recognition of pathogen related products automatically mapped to Pfam PF02221 |
Protein automated matches [321839] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [321840] (1 PDB entry) |
Domain d5kwyd_: 5kwy D: [321841] Other proteins in same PDB: d5kwyc2 automated match to d1nepa_ complexed with c3s, nag |
PDB Entry: 5kwy (more details), 2.41 Å
SCOPe Domain Sequences for d5kwyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kwyd_ b.1.18.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} epvqfkdcgsvdgvikevnvspcptqpcqlskgqsysvnvtftsniqsksskavvhgilm gvpvpfpipepdgcksgincpiqkdktysylnklpvkseypsiklvvewqlqddknqslf cweipvqivshl
Timeline for d5kwyd_: