Lineage for d5lp7b1 (5lp7 B:2-268)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (69 species)
    not a true protein
  7. 2489101Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries)
  8. 2489120Domain d5lp7b1: 5lp7 B:2-268 [321818]
    automated match to d3goaa1
    complexed with gol

Details for d5lp7b1

PDB Entry: 5lp7 (more details), 2.2 Å

PDB Description: crystal structure of 3-ketoacyl-coa thiolase (mmga) from bacillus subtilis.
PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d5lp7b1:

Sequence, based on SEQRES records: (download)

>d5lp7b1 c.95.1.0 (B:2-268) automated matches {Bacillus subtilis [TaxId: 224308]}
rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags
gqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsni
pyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalr
sharaakaadegkfqdeivpvnwigrkgkpnvvdkdeairrdtsldqlaklapiyasdgs
itagnapgvndgagafvlmseekaael

Sequence, based on observed residues (ATOM records): (download)

>d5lp7b1 c.95.1.0 (B:2-268) automated matches {Bacillus subtilis [TaxId: 224308]}
rktvivsaartpfgkfggvlkevkaaelggivmkealqqagvsgddvegnvmgmvvqags
gqipsrqaarlagmpwsvpsetlnkvcasglravtlcdqmiraqdadilvaggmesmsni
pyavpagrwgarmgdgelrdlmvydgltcafdevhmavhgntaakeyaisrreqdewalr
sharaakaadegkfqdeivpvnwigkpnvvdkdeairrdtsldqlaklapiysdgsitag
napgvndgagafvlmseekaael

SCOPe Domain Coordinates for d5lp7b1:

Click to download the PDB-style file with coordinates for d5lp7b1.
(The format of our PDB-style files is described here.)

Timeline for d5lp7b1: