Lineage for d5k3gd1 (5k3g D:2-280)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015761Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321813] (4 PDB entries)
  8. 3015783Domain d5k3gd1: 5k3g D:2-280 [321814]
    Other proteins in same PDB: d5k3ga2, d5k3ga3, d5k3gb2, d5k3gb3, d5k3gc2, d5k3gc3, d5k3gd2, d5k3gd3
    automated match to d2ddha3

Details for d5k3gd1

PDB Entry: 5k3g (more details), 2.86 Å

PDB Description: crystals structure of acyl-coa oxidase-1 in caenorhabditis elegans, apo form-i
PDB Compounds: (D:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3gd1 e.6.1.0 (D:2-280) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
kmaynivdngflgfnnyriprtnllmrhtkveadgtyik

SCOPe Domain Coordinates for d5k3gd1:

Click to download the PDB-style file with coordinates for d5k3gd1.
(The format of our PDB-style files is described here.)

Timeline for d5k3gd1: