Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [269137] (4 PDB entries) |
Domain d5dasd1: 5das D:4-200 [321785] Other proteins in same PDB: d5dasa2, d5dasb2, d5dasc2, d5dasd2 automated match to d4s1ob_ complexed with nap |
PDB Entry: 5das (more details), 2.2 Å
SCOPe Domain Sequences for d5dasd1:
Sequence, based on SEQRES records: (download)
>d5dasd1 c.26.1.0 (D:4-200) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy lmpdgvvqyvskrrlyt
>d5dasd1 c.26.1.0 (D:4-200) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpvsaaehrylmtviatasnp rfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimseelfelarfvgvs rpaltlveipalaisstdcrqraeqsrplwylmpdgvvqyvskrrlyt
Timeline for d5dasd1: