Lineage for d5jtpa_ (5jtp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943083Fold d.33: SecB-like [54610] (1 superfamily)
    beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432
  4. 2943084Superfamily d.33.1: SecB-like [54611] (3 families) (S)
  5. 2943115Family d.33.1.0: automated matches [321736] (1 protein)
    not a true family
  6. 2943116Protein automated matches [321737] (2 species)
    not a true protein
  7. 2943122Species Escherichia coli [TaxId:83334] [321738] (6 PDB entries)
  8. 2943123Domain d5jtpa_: 5jtp A: [321748]
    automated match to d1fx3b_

Details for d5jtpa_

PDB Entry: 5jtp (more details)

PDB Description: the structure of chaperone secb in complex with unstructured prophoa binding site e
PDB Compounds: (A:) protein-export protein secb

SCOPe Domain Sequences for d5jtpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jtpa_ d.33.1.0 (A:) automated matches {Escherichia coli [TaxId: 83334]}
mseqnntemtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvl
rvtvtaslgeetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsr
gtfpqlnlapvnfdalfmnylqqqagegteehqda

SCOPe Domain Coordinates for d5jtpa_:

Click to download the PDB-style file with coordinates for d5jtpa_.
(The format of our PDB-style files is described here.)

Timeline for d5jtpa_: