Lineage for d5i34b_ (5i34 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452090Species Cryptococcus neoformans [TaxId:235443] [321716] (3 PDB entries)
  8. 2452092Domain d5i34b_: 5i34 B: [321720]
    automated match to d3ue9a_
    complexed with gdp, imp

Details for d5i34b_

PDB Entry: 5i34 (more details), 1.53 Å

PDB Description: adenylosuccinate synthetase from cryptococcus neoformans complexed with gdp and imp
PDB Compounds: (B:) adenylosuccinate synthetase

SCOPe Domain Sequences for d5i34b_:

Sequence, based on SEQRES records: (download)

>d5i34b_ c.37.1.0 (B:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
spegvtvvlgaqwgdegkgklvdilaaeadicarcaggnnaghtivvrndkgektsyafn
llpsglinpectafigsgvvvhvpslfneldtlerkglkvagrllvsdrahlvmgfhqiv
dglkevelggssigttrkgigpaysskasrsglrvhhlfdptfpakfrklvegrfkrygh
fefdtegeiemylafaerlrpfivdgptfmhnalssgkrvlveganalmldldygtypfv
tssstsiggvvsglgispfaikrvvgvikayttrvgggpfptedlatvgetlqevgaeyg
tvtgrrrrcgwldlvvmkystmingytslnltkldvldgfeeikvatgykidgvevegfp
adldrlakvevqyatlpgwktdisncktyeefpenakayikfiedylgvkvqyvgvgpgr
dqnviif

Sequence, based on observed residues (ATOM records): (download)

>d5i34b_ c.37.1.0 (B:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
spegvtvvlgaqwgdegkgklvdilaaeadicarcaggnnaghafnllpsglinpectaf
igsgvvvhvpslfneldtlerkglkvagrllvsdrahlvmgfhqivdglkevelggssig
ttrkgigpaysskasrsglrvhhlfdptfpakfrklvegrfkryghfefdtegeiemyla
faerlrpfivdgptfmhnalssgkrvlveganalmldldygtypfvtssstsiggvvsgl
gispfaikrvvgvikayttrvgggpfptedlatvgetlqevgaeygtvtgrrrrcgwldl
vvmkystmingytslnltkldvldgfeeikvatgykidgvevegfpadldrlakvevqya
tlpgwktdisncktyeefpenakayikfiedylgvkvqyvgvgpgrdqnviif

SCOPe Domain Coordinates for d5i34b_:

Click to download the PDB-style file with coordinates for d5i34b_.
(The format of our PDB-style files is described here.)

Timeline for d5i34b_: