Lineage for d5i34a_ (5i34 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871818Species Cryptococcus neoformans [TaxId:235443] [321716] (3 PDB entries)
  8. 2871819Domain d5i34a_: 5i34 A: [321718]
    automated match to d3ue9a_
    complexed with gdp, imp

Details for d5i34a_

PDB Entry: 5i34 (more details), 1.53 Å

PDB Description: adenylosuccinate synthetase from cryptococcus neoformans complexed with gdp and imp
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d5i34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i34a_ c.37.1.0 (A:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
apspegvtvvlgaqwgdegkgklvdilaaeadicarcaggnnaghtivvrndkgektsya
fnllpsglinpectafigsgvvvhvpslfneldtlerkglkvagrllvsdrahlvmgfhq
ivdglkevelggssigttrkgigpaysskasrsglrvhhlfdptfpakfrklvegrfkry
ghfefdtegeiemylafaerlrpfivdgptfmhnalssgkrvlveganalmldldygtyp
fvtssstsiggvvsglgispfaikrvvgvikayttrvgggpfptedlatvgetlqevgae
ygtvtgrrrrcgwldlvvmkystmingytslnltkldvldgfeeikvatgykidgveveg
fpadldrlakvevqyatlpgwktdisncktyeefpenakayikfiedylgvkvqyvgvgp
grdqnviif

SCOPe Domain Coordinates for d5i34a_:

Click to download the PDB-style file with coordinates for d5i34a_.
(The format of our PDB-style files is described here.)

Timeline for d5i34a_: