Lineage for d5d8de2 (5d8d E:99-307)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 2541795Species Acinetobacter baumannii [TaxId:405416] [321246] (2 PDB entries)
  8. 2541800Domain d5d8de2: 5d8d E:99-307 [321677]
    Other proteins in same PDB: d5d8da1, d5d8db1, d5d8dc1, d5d8dd1, d5d8de1, d5d8df1
    automated match to d4egjc2

Details for d5d8de2

PDB Entry: 5d8d (more details), 2.19 Å

PDB Description: crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii
PDB Compounds: (E:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5d8de2:

Sequence, based on SEQRES records: (download)

>d5d8de2 d.142.1.0 (E:99-307) automated matches {Acinetobacter baumannii [TaxId: 405416]}
dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhegssvgmskvekaed
faaaiekatqhdavvmaekwitgreftisflngqplpvirlqppadvafydyeakyqrnd
veygipcglseteekklqalclrafqavgaegwgridamqdeqgnfwllevntvpgmtsh
slvpkaakavgysfdelcvaileqtlegt

Sequence, based on observed residues (ATOM records): (download)

>d5d8de2 d.142.1.0 (E:99-307) automated matches {Acinetobacter baumannii [TaxId: 405416]}
dkvktkqiwqgsdlptapyriitketdldsviaelglpviikpvhvgmskvaedfaaaie
katavvmaekwitgreftisflngqplpvirlqgipcglseteekklqalclrafqavga
egwgridamqdeqgnfwllevntvpgmtshslvpkaakavgysfdelcvaileqtlegt

SCOPe Domain Coordinates for d5d8de2:

Click to download the PDB-style file with coordinates for d5d8de2.
(The format of our PDB-style files is described here.)

Timeline for d5d8de2: