Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311424] (13 PDB entries) |
Domain d5lf3m_: 5lf3 M: [321658] Other proteins in same PDB: d5lf3a_, d5lf3b_, d5lf3c_, d5lf3d_, d5lf3g_, d5lf3h_, d5lf3j_, d5lf3k_, d5lf3l_, d5lf3n1, d5lf3n2, d5lf3o_, d5lf3p_, d5lf3q_, d5lf3r_, d5lf3u_, d5lf3v_, d5lf3x_, d5lf3y_, d5lf3z_ automated match to d4j70m_ complexed with 1pe, bo2, cl, k, mg |
PDB Entry: 5lf3 (more details), 2.1 Å
SCOPe Domain Sequences for d5lf3m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lf3m_ d.153.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd arsynrfqiatvtekgveiegplstetnwdiahmis
Timeline for d5lf3m_:
View in 3D Domains from other chains: (mouse over for more information) d5lf3a_, d5lf3b_, d5lf3c_, d5lf3d_, d5lf3e_, d5lf3f_, d5lf3g_, d5lf3h_, d5lf3i_, d5lf3j_, d5lf3k_, d5lf3l_, d5lf3n1, d5lf3n2, d5lf3o_, d5lf3p_, d5lf3q_, d5lf3r_, d5lf3s_, d5lf3t_, d5lf3u_, d5lf3v_, d5lf3w_, d5lf3x_, d5lf3y_, d5lf3z_ |